We are Announcing Perfect Package for you Digimason Web is proving you with the perfect package according to your need at the best prices possible.

ECOMMERCE

Rs.4000/M Regularly Rs.5000 Book Now
  • Unlimited Web Space
  • Unlimited Bandwidth
  • FREE Domain Registar
  • 24/7/365 Support
  • Dynamic Website design
  • 50 Web Pages
  • 24/7/365 Support
  • FREEContact Form
  • 99.9% Service Uptime
  • 30 Day Money Back Guarantee
  • Search Box
  • Featured Products
  • Related product
  • Newsletter Subscription
  • Product Zoom
  • Payment Gateway
  • Privacy Policy
  • Customer login & registration
  • Delivery Information
  • Seller Dashboard
  • Price Filter
  • Google Analytics
  • Location Map
  • Facebook fan page
  • User panel unlimited
  • Automatic email responder
  • On Page SEO

STARTER

Rs.8000/Y Regularly Rs.8500 Book Now
  • 500MB Web Space
  • 5GB Bandwidth
  • FREE Domain Registar
  • 24/7/365 Support
  • Dynamic Website design
  • 5 Web Pages
  • 24/7/365 Support
  • FREEContact Form
  • 99.9% Service Uptime
  • 30 Day Money Back Guarantee
  • -
  • -
  • -
  • -
  • -
  • -
  • -
  • -
  • -
  • -
  • -
  • -
  • -
  • -
  • -
  • -
  • -

BUSINESS

Rs.15000/Y Regularly Rs.18000 Book Now
  • 5GB Web Space
  • 10GB Bandwidth
  • FREE Domain Registar
  • 24/7/365 Support
  • Website design Dynamic
  • 10 Web Pages
  • FREE Blogs
  • FREEContact Form
  • 99.9% Service Uptime
  • 30 Day Money Back Guarantee
  • CMS Support
  • Email account 5
  • Google Map
  • Contact Form
  • Backen panel Design
  • Photo Gallery
  • Social networking link integration
  • Google Analytics
  • Location Map
  • Facebook fan page
  • User panel 1
  • -
  • -
  • -
  • -
  • -
  • -

PREMIUM

Rs.20000/Y Regularly Rs.22000 Book Now
  • 10GB Web Space
  • 15GB Bandwidth
  • FREE Domain Registar
  • 24/7/365 Support
  • Website design Dynamic
  • 15 Web Pages
  • FREE Blogs
  • FREEContact Form
  • 99.9% Service Uptime
  • 30 Day Money Back Guarantee
  • CMS Support
  • Email account 5
  • Google Map
  • Contact Form
  • Backen panel Design
  • Photo Gallery
  • Social networking link integration
  • Google Analytics
  • Location Map
  • Facebook fan page
  • User panel unlimited
  • Video Gallery
  • Mobile website
  • Newsletter
  • Automatic email responder
  • -
  • -

What makes Digimason Web the Best among the rest?

Money Back Guarantee

You can cancel at any time and get a refund for the unused hours.

Specialization Benefits

Based on your requirements, you can hire resources that are most ideal for your requirements.

On-time delivery

Because of we offer dedicated resources, we can deliver work on time.

White Label Services

Own your own Web Development Business at no setup cost and overheads.

Expertise

We recruit our employees from the most reputed engineering colleges across India.

Security

We work under strict Non Disclosure Agreements (NDAs) and we take customer confidentiality very seriously.

Flexibility in Pricing

You can hire on-demand resources on full-time, part-time or hourly basis.

Free 24×7/365 Support

You can reach our team at any time, day or night.

Happy Customers

Our motivation comes from the feedback of hundreds of satisfied clients around the world.

What is in hot demand?

Get Your Own Mobile App today Android / iOS
  • In The world of Smart Phones, it is a must.
  • Push Notifications, So that the customer can get all updates.
  • Free upload on Google Play / iOS Store.
    Contact us now
  • Contact Us
Easy to Use, Manage & Sell. Online Store
  • GET MORE CUSTOMERS with built-in SEO tools.
  • Custom Modules according to your needs.
  • SAVE MONEY with free hosting and unlimited bandwidth.
    So Contact Us today!
  • Contact Us

How to Earn Money developing a Website?
Check the video to know more.

Watch videos to
know more

X

Latest News / Blogs

Have Questions?

Where is Digimason Web Located?

We are located in Salt Lake, Kolkata, India. But we have clients across the globe in all continents around the world.

Can I get my website listed in Google?

Certainly, once you create your site, simply post your URL to Google’s free site submission page. Note: It may take a few days to a few weeks to get listed.

What is my yearly Cost ?

If what you are using is a website, then your yearly cost will be around INR 2000 for Domain and Hosting renewal, as you need to renew then annually. There us no cost for Digimason Web codes renewal, Its only one time payment during development.

Does Digimason Web offer phone support?

Yes! We are available for Phone Support 24/7 for 365 days in a year. You have to simply call us at +91 33 6541-6650.

What do we offer ?

Website Builder packages provide quality web hosting with unlimited resources.

With ArkaHost’s website builder, it’s easy to create a sleek and professional website for your business. Choose from 40 fully customizable, mobile-friendly templates, and then drag and drop your content wherever you please.

 

Learn More

Domain packages provide quality web hosting with unlimited resources.

ArkaHost is an ICANN-accredited domain name registrar. In addition to great pricing and a commitment to world-class customer service, we offer web hosting, email, website builder, premium and expired domain names, and SSL certificates.

 

Learn More

eCommerce packages provide quality web hosting with unlimited resources.

Customize your store’s look and feel. Choose from 100s of designer made templates, and change anything you want to create your professional eCommerce website. Just drag n’ drop. No tech skills needed.

 

Learn More

Mobile website packages provide quality web hosting with unlimited resources.

Create a mobile website in just a few easy steps. Simply enter your desktop site’s URL and we’ll automatically create its mobile version, completely filled with all of your content.

 

Learn More

Secure-Fast-Reliable Shared Hosting

All hosting features used tempalte


Read More
Trust Partner your Choice Reseller Hosting

All hosting features used tempalte


Read More
Storing Resources Cloud Computing

All hosting features used tempalte


Read More

More than 2,000 websites have been developed by us!

get your website online today

Projects

2865

Clients

2000

Awards

5

Domains

2200

Days

1003

Why don't you give us the chance to feature your website here also ?

Here are some of the best websites developed by us!

»
«

We work on -

  • codeigniter
  • apps
  • c0d23d2d6769e53e24a1b3136c064577-php_logo

why customers us!

aswinisandeepmarydeepikasardarheenataniayogeswar